PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.09G168700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family NF-YB
Protein Properties Length: 142aa    MW: 16127 Da    PI: 5.3405
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.09G168700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1611.8e-50398297
                NF-YB  2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93
                          eqdr+lPianv+rimk++lP  akisk+aket+qec++efisfvt+easdkc++e+rkt+ngdd++wal++lGf++y +++  yl+kyre+
  Manes.09G168700.1.p  3 DEQDRLLPIANVGRIMKQILPPTAKISKEAKETMQECATEFISFVTGEASDKCHKENRKTLNGDDICWALSSLGFDNYSQAIVRYLHKYREA 94
                         69****************************************************************************************** PP

                NF-YB 94 egek 97
                         e+e+
  Manes.09G168700.1.p 95 ERER 98
                         *997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.4E-522121IPR009072Histone-fold
SuperFamilySSF471136.65E-405127IPR009072Histone-fold
PfamPF008085.3E-27872IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.6E-173654No hitNo description
PROSITE patternPS0068503955IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.6E-175573No hitNo description
PRINTSPR006152.6E-177492No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 142 aa     Download sequence    Send to blast
MVDEQDRLLP IANVGRIMKQ ILPPTAKISK EAKETMQECA TEFISFVTGE ASDKCHKENR  60
KTLNGDDICW ALSSLGFDNY SQAIVRYLHK YREAERERSA NQNKATASTQ EKDEQELQTE  120
TPTPMEFRVL EKGNSSSSFR Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B3e-41293192Transcription factor HapC (Eurofung)
4g92_B3e-41293192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002512405.13e-77PREDICTED: nuclear transcription factor Y subunit B-4
RefseqXP_011023651.12e-77PREDICTED: nuclear transcription factor Y subunit B-4-like
SwissprotO040274e-60NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBLB9RF863e-77B9RF86_RICCO; Ccaat-binding transcription factor subunit A, putative
STRINGPOPTR_0013s02030.11e-75(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.12e-61nuclear factor Y, subunit B4